#include <StringConstants.au3> ; to declare the Constants of StringRegExp
#include <Array.au3> ; UDF needed for _ArrayDisplay and _ArrayConcatenate
Local $sRegex = "(?m)>sp\|(\w+)\|.+?SV=\d\s([A-Z]+)"
Local $sString = ">sp|A0A385XJ53|INSA9_ECOLI Insertion element OS=Escherichia coli (strain K12) PE=3 SV=1 MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMA >sp|A0A385XJE6|INH21_ECOLI Transposase InsH for insertion sequence element OS=Escherichia coli (strain K12) PE=3 SV=1 MFVIWSHRTGFIMSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPFYPKA >sp|A0A385XJL4|INSB9_ECOLI Insertion element IS1 9 protein OS=Escherichia coli (strain K12) PE=3 SV=2 MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLF" & @CRLF & _
""
Local $aArray = StringRegExp($sString, $sRegex, $STR_REGEXPARRAYGLOBALFULLMATCH)
Local $aFullArray[0]
For $i = 0 To UBound($aArray) -1
_ArrayConcatenate($aFullArray, $aArray[$i])
Next
$aArray = $aFullArray
; Present the entire match result
_ArrayDisplay($aArray, "Result")
Please keep in mind that these code samples are automatically generated and are not guaranteed to work. If you find any syntax errors, feel free to submit a bug report. For a full regex reference for AutoIt, please visit: https://www.autoitscript.com/autoit3/docs/functions/StringRegExp.htm