const regex = />sp\|(\w+)\|.+?SV=\d\s([A-Z]+)/gm;
// Alternative syntax using RegExp constructor
// const regex = new RegExp('>sp\\|(\\w+)\\|.+?SV=\\d\\s([A-Z]+)', 'gm')
const str = `>sp|A0A385XJ53|INSA9_ECOLI Insertion element OS=Escherichia coli (strain K12) PE=3 SV=1 MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMA >sp|A0A385XJE6|INH21_ECOLI Transposase InsH for insertion sequence element OS=Escherichia coli (strain K12) PE=3 SV=1 MFVIWSHRTGFIMSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPFYPKA >sp|A0A385XJL4|INSB9_ECOLI Insertion element IS1 9 protein OS=Escherichia coli (strain K12) PE=3 SV=2 MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLF
`;
// Reset `lastIndex` if this regex is defined globally
// regex.lastIndex = 0;
let m;
while ((m = regex.exec(str)) !== null) {
// This is necessary to avoid infinite loops with zero-width matches
if (m.index === regex.lastIndex) {
regex.lastIndex++;
}
// The result can be accessed through the `m`-variable.
m.forEach((match, groupIndex) => {
console.log(`Found match, group ${groupIndex}: ${match}`);
});
}
Please keep in mind that these code samples are automatically generated and are not guaranteed to work. If you find any syntax errors, feel free to submit a bug report. For a full regex reference for JavaScript, please visit: https://developer.mozilla.org/en/docs/Web/JavaScript/Guide/Regular_Expressions