using System;
using System.Text.RegularExpressions;
public class Example
{
public static void Main()
{
string pattern = @">sp\|(\w+)\|.+?SV=\d\s([A-Z]+)";
string input = @">sp|A0A385XJ53|INSA9_ECOLI Insertion element OS=Escherichia coli (strain K12) PE=3 SV=1 MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMA >sp|A0A385XJE6|INH21_ECOLI Transposase InsH for insertion sequence element OS=Escherichia coli (strain K12) PE=3 SV=1 MFVIWSHRTGFIMSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPFYPKA >sp|A0A385XJL4|INSB9_ECOLI Insertion element IS1 9 protein OS=Escherichia coli (strain K12) PE=3 SV=2 MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLF
";
RegexOptions options = RegexOptions.Multiline;
foreach (Match m in Regex.Matches(input, pattern, options))
{
Console.WriteLine("'{0}' found at index {1}.", m.Value, m.Index);
}
}
}
Please keep in mind that these code samples are automatically generated and are not guaranteed to work. If you find any syntax errors, feel free to submit a bug report. For a full regex reference for C#, please visit: https://msdn.microsoft.com/en-us/library/system.text.regularexpressions.regex(v=vs.110).aspx